For laboratory research use only · Not for human consumption

Axis Bio.
Back to catalog
lot ABL-CJC-2602
≥99% HPLC · RUO

GH axis

CJC-1295 (no DAC)

Modified GRF(1-29)

Growth hormone releasing hormone analog

A tetrasubstituted analog of GHRH(1-29) engineered for metabolic stability. Widely used in preclinical research on pulsatile growth hormone release.


For laboratory research use only. Not for human or animal consumption, not a drug, food, cosmetic, or supplement. By adding to cart, the researcher affirms compliance with all applicable regulations.

Vial size

Research price

$39

SKU ABL-CJC-2

Ships cold-chain · Lot ABL-CJC-2602 · Checkout secured by Waave

Specifications

CAS number
863288-34-0
Molecular formula
C152H252N44O42
Molecular weight
3367.97 g/mol
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Purity (HPLC)
≥99%
Appearance
White lyophilized powder
Storage
Store lyophilized at −20 °C, protected from light and moisture
Reconstitution
Reconstitute in sterile diluent appropriate to researcher protocol
Latest lot
ABL-CJC-2602

CJC-1295 without DAC, also referred to as Modified GRF(1-29), is a synthetic analog of the first 29 amino acids of endogenous GHRH, with substitutions (D-Ala², Gln⁸, Ala¹⁵, Leu²⁷) that confer resistance to proteolytic cleavage.

Published preclinical and early clinical literature has investigated the peptide's action at the pituitary GHRH receptor and its influence on pulsatile GH release in animal models and healthy human volunteers.

The peptide is commonly used in laboratory settings to interrogate GH axis physiology, often paired with a GH secretagogue such as Ipamorelin in dual-stimulation research protocols.